Kharazmkia, Ali and Ziaie, Shadi and Moradi, Omid and Ahmadpoor, Pedram (2020) ATriple-BlindRandomizedControlledTrialonImpactsof PioglitazoneonOxidativeStressMarkersinDiabeticKidney TransplantRecipients. ShirazE-Med.
|
Text
semj-In_Press-In_Press-98656.pdf Download (155kB) | Preview |
Abstract
Background:Oxidativestressasamajormediatorof adverseoutcomesinkidneytransplantrecipientswhoarepronetooxidative stress-mediatedinjurybypre-transplantandpost-transplantconditions. Objectives: The purpose of this study was to assess the effects of Pioglitazone on oxidative stress biomarkers and blood glucose controlindiabeticpatientsreceivinginsulinafterkidneytransplantation. Methods: In a triple-blind randomized placebo-controlled trial, sixty-two kidney transplanted diabetic patients (40 men and 24 women) were followed for 4 months after randomly assigned to the placebo group and Pioglitazone group (30 mg/d). All of the patientscontinuedtheirinsulintherapyirrespectiveof thegroupthattheywereassignedtoevaluatetheeffectsof theadditionof pioglitazone on blood glucose and oxidative stress biomarkers, Malondialdehyde (MDA) and total protein carbonyls (TPC) serum levels. Results: At baseline, there were no statistically significant differences in glycemic control levels and oxidative markers between thetwogroups. After4monthsof intervention,asignificantimprovementoccurredinHemoglobinA1c (HBA1c)inthePioglitazone group.ThechangesofHBA1cduring4monthsoffollowupinthePioglitazonegroupshowimprovementinglucosecontrolwereas HBA1cintheplacebogroupincreasedby0.3% (P=0.0001). Moreover,attheendof thestudy,theMDAlevelwassignificantlylower in the Pioglitazone group (P < 0.0001, 1.22 - 3.90). Regarding the serum level of TPC, the changes were not statistically different at baselineandalsoattheendof thestudybetweentwogroups. Conclusions: Administration of Pioglitazone in addition to insulin in diabetic kidney transplant patients not only improved glycemiccontrol(evidencedbyHBA1c)butalsosignificantlydecreasedoxidativestressmarkerssuchasMDA. Keywords: KidneyTransplantation,OxidativeStress,Pioglitazone,Thiazolidinediones,Malondialdehyde,ProteinCarbonylation
| Item Type: | Article |
|---|---|
| Subjects: | R Medicine > RC Internal medicine > RC0321 Neuroscience. Biological psychiatry. Neuropsychiatry |
| Divisions: | Faculty of Medicine, Health and Life Sciences > School of Medicine |
| Depositing User: | samira sepahvandy |
| Date Deposited: | 15 Aug 2020 04:22 |
| Last Modified: | 15 Aug 2020 04:22 |
| URI: | http://eprints.lums.ac.ir/id/eprint/2257 |
Actions (login required)
 |
View Item |
